PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10008110m
Common NameCICLE_v10007904mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family WRKY
Protein Properties Length: 493aa    MW: 52971.8 Da    PI: 4.5086
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10008110mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.81.9e-32302359260
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                      +DgynWrKYGqK+vkgse+prsYY+Ct+++C+vkkkvers  +++++ei+Y+g Hnh+k
  Ciclev10008110m 302 EDGYNWRKYGQKQVKGSEYPRSYYKCTHPNCQVKKKVERSL-EGHITEIIYKGAHNHPK 359
                      7****************************************.***************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081122.848296360IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.2E-28300360IPR003657WRKY domain
SMARTSM007746.8E-36301359IPR003657WRKY domain
SuperFamilySSF1182901.57E-25301360IPR003657WRKY domain
PfamPF031069.6E-25302358IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0009942Biological Processlongitudinal axis specification
GO:0030010Biological Processestablishment of cell polarity
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 493 aa     Download sequence    Send to blast
MVMAGIDDNM AVIGDWVPPS PSPRTFFAAI SGDDISSREP PSENGVDGLS LGSQEQMTSG  60
NTEKKNMMTG GASTDLGPFS EQKSRLAARA GFNAPRLNTE SIRTSDLSLN PDIRSPYLTI  120
PPGLSPTTLL ESPVFLSNSL AQPSPTTGKF SFIPNGNGKS STCISEAPDK SKDNILEDIN  180
TSFAFKPVAE SGSFSLGTRN KQSFPSIEVS VQSENSPQNV NAAKVHSQYR NSLSLQVQTD  240
FSRATTEKDN GCNTILADQR VFDTFGGSTE HSPPLDEQQD EEGDQRGSGD SMVAGAGGAS  300
SEDGYNWRKY GQKQVKGSEY PRSYYKCTHP NCQVKKKVER SLEGHITEII YKGAHNHPKP  360
PPNRRSAIGS NPLDMQLDIH EQAGLQSGAD GDPSWANTQK GTAGGTPEWR HDTVEVTSAA  420
PVGPEYCNQS SALPAQNGTP YESGDAVDAS STFSNDEDED DQVTHCSVGF DGEEDESESK  480
RRYLFPFSIF LL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A1e-173033611675WRKY transcription factor 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00071PBMTransfer from AT5G56270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006452782.10.0hypothetical protein CICLE_v10007904mg
SwissprotQ9FG771e-108WRKY2_ARATH; Probable WRKY transcription factor 2
TrEMBLV4UIP70.0V4UIP7_9R
STRINGPOPTR_0011s17230.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.11e-110WRKY DNA-binding protein 2